PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100120480081
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family G2-like
Protein Properties Length: 443aa    MW: 48905.1 Da    PI: 8.9005
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100120480081genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like888.7e-28176229256
                       G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                                    +++WtpeLH++Fv+aveqL G +kA+P++ilelm++++Lt+++v+SHLQkYR++
  Ote100120480081|100120480081 176 GKVDWTPELHRQFVQAVEQL-GVDKAVPSKILELMGIDCLTRHNVASHLQKYRSH 229
                                   5899****************.********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.328172231IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.3E-27173232IPR009057Homeodomain-like
SuperFamilySSF466893.4E-19173232IPR009057Homeodomain-like
TIGRFAMsTIGR015577.2E-26175229IPR006447Myb domain, plants
PfamPF002493.0E-8178227IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010638Biological Processpositive regulation of organelle organization
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 443 aa     Download sequence    Send to blast
MSLRSSDAEE KRRSREFRFR YSFVEFLRVI CQLSENDASM RRSWRRSCGS ESVLQALILD  60
GNEFAREHEL DLEMDPRISA EISSSAGEES EMSTEATGSV QVDKVREGNI SIKEDKTPAA  120
SASASASNHG SGSSIIQGEE PVSTREDLVA DEYPRKVDKG RKSSAQINKV SGKKKGKVDW  180
TPELHRQFVQ AVEQLGVDKA VPSKILELMG IDCLTRHNVA SHLQKYRSHR KHMLARESEV  240
ATWSRKRQLY RSTGSTRKND ANSWVVPTTG FPPVTSVSRS RPIHVWGHPS PNQSLVYMWP  300
SHLASSPSPP PWAAGHPPPR PLPGDPSFWN YHHQDVPAQG MVCYPSHYPQ PTFASPPVPG  360
LPPSSMYRAA PSIGVPVNVP GQKMAQPVQD SHLQSTESID AVIGDVLSKP WLPLPLGLKP  420
PSVDSVVVEL QRQGISKIPP TCA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A8e-17171227157ARR10-B
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011100407.11e-151PREDICTED: probable transcription factor GLK1
TrEMBLA0A022QJU01e-150A0A022QJU0_ERYGU; Uncharacterized protein
STRINGVIT_12s0028g03100.t011e-114(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA25322356